SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR117W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR117W
Domain Number 1 Region: 344-509
Classification Level Classification E-value
Superfamily TPR-like 5.63e-29
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 125-219
Classification Level Classification E-value
Superfamily TPR-like 6.78e-26
Family Tetratricopeptide repeat (TPR) 0.00082
Further Details:      
 
Domain Number 3 Region: 477-589
Classification Level Classification E-value
Superfamily TPR-like 0.0000000182
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YHR117W
Sequence length 639
Comment TOM71 ORF Verified Mitochondrial outer membrane protein with similarity to Tom70p; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins
Sequence
MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG
QNEDEADLKDDGSVVNGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP
SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
ALQRLYSATDEGYLVANDLLTKSTDMYHALLSANTVDDPLRENAALAFCYTGIFHFLKNN
LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAIDLNPEYPPTYYHRGQ
MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
EVPTFFAEILTDKGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML
Download sequence
Identical sequences YHR117W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]