SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL073C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL073C
Domain Number - Region: 452-554
Classification Level Classification E-value
Superfamily TPR-like 0.00237
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIL073C
Sequence length 975
Comment SPO22 ORF Verified Meiosis-specific protein essential for chromosome synapsis, involved in completion of nuclear divisions during meiosis; induced early in meiosis
Sequence
MSDHNVNSTFRKTLVELCETATWITSQVYAAKNLEKNDLITVDNKISALYPIAEKYDRSF
RTTTVILDEELILKLENAASSLWNSLTIAMKAEKASDKYFNEVFCKCKIFATKLLSIHEA
LFRTNTNLLRNFKCYISSFKSASEYRFDDLITNTQQHSEKYLQIINEHVESFSNEEKTEF
KKLTFEFYLVNFQLYLSENDLDTANIYTAKVNITDNSKYMDADLLIELCRMIYNSTVMLK
EINDPETQLVDVNIISFLKDVEKYLELPVENLKSHTDYSNLKYSVLIFMANCLVEGYPQA
SELEQCDHYLSLLQNEYPNKVDPFILAINLTKRRNIVNPAETIEEILMRMIMSVDVISNF
QAVIASINDLSKMDTKFSIVCLDYLLTNKLNSKNDSKFLEKAICSRFLITTQSKTMNDSE
IAESLENFSTQMERIVSEPLTKHAISCIITLLWNTGKKLEKMEKYVVSIRFYKLALKDII
SQNYSDRGKIQRALQVVYNKIEDYSNTVRVYQDMDEVDRQSPLCQLLMLQSFLADDKTEE
ALTCLQKIKSSEDEKSTDALILAVAECKRKTDLSVQGLLMIFDKLQSKSNSQTISSTSSS
QTLSILRYTLQMIVKVSEEEPLETFINYLPTVQKLLQKAVEFLKTVKLLNQLPPDVEKEA
IYQQSVAVNEIEWFASFSYNVAVKCLVDQSCESISEFPQYCIQFIDLIPVQDFTFPKMYH
FTYWKFKATILQLIIAKGKAKQDQHQKDWDIYEKSEELVNSINVMKKSSEFKDGSSLEDR
NTLHECFLEALTIHLESALIMPDQTRILDILKKTELYQDSRVDALLIDISSNMEDLPKGV
LIEILETVLKRNMGPEVKEQEICSWLRILLENAINLNHEVELRILDRVLKILNINQSSLQ
DTDGVLQTELETIATYCWNIGVNYIIKDNKSNGIVWCKHSMGFANMVNEGLQEQLYSLWE
SLASSANIDINSIAK
Download sequence
Identical sequences YIL073C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]