SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR024W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR024W
Domain Number 1 Region: 122-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.13e-35
Family Glutathione peroxidase-like 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR024W
Sequence length 221
Comment SCO2 ORF Verified Protein anchored to the mitochondrial inner membrane, similar to Sco1p and may have a redundant function with Sco1p in delivery of copper to cytochrome c oxidase; interacts with Cox2p
Sequence
MLNSSRKYACRSLFRQANVSIKGLFYNGGAYRRGFSTGCCLRSDNKESPSARQPLDRLQL
GDEINEPEPIRTRFFQFSRWKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVA
LGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKI
QPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSV
Download sequence
Identical sequences E7QBD9
YBR024W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]