SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR098C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR098C
Domain Number 1 Region: 103-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.55e-25
Family Thioltransferase 0.00027
Further Details:      
 
Weak hits

Sequence:  YDR098C
Domain Number - Region: 37-101
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family Diap1 N-terninal region-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR098C
Sequence length 202
Comment GRX3 ORF Verified Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; monothiol glutaredoxin subfamily member along with Grx4p and Grx5p; protects cells from oxidative damage
Sequence
MSLPIPTSLSYPLMRTKTRKFQNFLKSQLFHIFIIIHKGTILKELSGADPKEFVSLLEDC
KNSVNSXSSQTHTMENANVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMK
GSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPTFPQLYINGEFQG
GLDIIKESLEEDPDFLQHALQS
Download sequence
Identical sequences YDR098C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]