SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR161W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR161W
Domain Number 1 Region: 48-104,131-190
Classification Level Classification E-value
Superfamily TPR-like 0.000000183
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR161W
Sequence length 302
Comment ORF Uncharacterized Putative protein of unknown function; non-essential gene; proposed function in rRNA and ribosome biosynthesis based on transcriptional co-regulation; genetic interactions suggest a role in ER-associated protein degradation (ERAD)
Sequence
MGQIMGGQDGVSIITRGIXNISNTGGEMLTNVQVEKIVGGLLSVIEIWMTDLCMEPNAEE
QCEELIQKAMELTEGKSPETWSTLGSIKISQQKFGEAYEAFSQAWNFFELKKQEIGSGIN
ENGDTTQKAGLQSEYVDLLQPLLSLTKMCLEVGAYEVALKVIAAVRDIDEDNIEGYYLEG
FTYYLMSKLEIFKLNNPEVSLRPENIYEFNQLIQEVPLDLSHEPISQLIYDSRLALSFAL
QAGVNADSKDEIVQELLGGANALLQEIGGPLDPSELTQIKKGDLVNENEDLEELDIEEEY
SD
Download sequence
Identical sequences YDR161W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]