SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR286C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR286C
Domain Number 1 Region: 15-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000142
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR286C
Sequence length 114
Comment ORF Uncharacterized Putative protein of unknown function; predicted to have thiol-disulfide oxidoreductase active site
Sequence
MLRAFRCSIHTSRVLLHDAGVKLTFFSKPNCGLCDQAKEVIDDVFERKEFHNKAVSLEIV
NITDRRNAKWWKEYCFDIPVLHIEKVGDPKSCTKILHFLEEDDISDKIRRMQSR
Download sequence
Identical sequences A6ZYN5 B3LG08 C7GQT7 C8Z5J8 E7KB44 E7KLX0 E7LT15 E7Q2H5 E7QD58 G2WB25 N1P722 Q05530
YDR286C YDR286C YDR286C NP_010572.3.97178 YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C tr|A6ZYN5|A6ZYN5_YEAS7 4932.YDR286C SCRT_00243 YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C YDR286C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]