SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER174C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER174C
Domain Number 1 Region: 145-234
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.02e-25
Family Thioltransferase 0.00032
Further Details:      
 
Domain Number 2 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.62e-24
Family Thioltransferase 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YER174C
Sequence length 244
Comment GRX4 ORF Verified Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; monothiol glutaredoxin subfamily member along with Grx3p and Grx5p; protects cells from oxidative damage; mutant has increased aneuploidy tolerance
Sequence
MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKSMSQVLEAVSEKVRQEDVRFLS
IDADKHPEISDLFEIAAVPYFVFIQNGTIVKEISGADPKEFVKSLEILSNASASLANNAK
GPKSTSDEESSGSSDDEEDETEDEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGI
LREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQ
HALQ
Download sequence
Identical sequences E7QE50
YER174C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]