SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR188C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGR188C
Domain Number - Region: 35-268
Classification Level Classification E-value
Superfamily TPR-like 0.0171
Family HAT/Suf repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR188C
Sequence length 402
Comment BUB1 ORF Verified Protein kinase that forms a complex with Mad1p and Bub3p that is crucial in the checkpoint mechanism required to prevent cell cycle progression into anaphase in the presence of spindle damage, associates with centromere DNA via Skp1p
Sequence
MNLDLGSTXRGYESDKDTFPXSKGVSSSQKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDL
FLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLS
NNFHESENTFKYMFNKGIGTKLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRXYNRL
LRSLSNYEDRLREMNIVENQNSVPDSRERLKGRLNYRTAPFFIRKFLTSSLMTDDKENRA
NLNSNVGVGKSAPNVYQDSIVVADFKSETERLNLNSSKQPSNQRLKNGNKKTSIYADQKQ
SNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQRRGKKHTEDY
TSDKNRKKRKLDVLVERRQDLPSSQPPVVPKSTRIEVFKDER
Download sequence
Identical sequences YGR188C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]