SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR209C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR209C
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.14e-35
Family SCOPe 0.0000976
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGR209C
Sequence length 104
Comment TRX2 ORF Verified Cytoplasmic thioredoxin isoenzyme of the thioredoxin system which protects cells against oxidative and reductive stress, forms LMA1 complex with Pbi2p, acts as a cofactor for Tsa1p, required for ER-Golgi transport and vacuole inheritance
Sequence
MVTQLKSASEYDSALASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDE
VSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV
Download sequence
Identical sequences A0A0L8VPU3 A6ZUM0 B3LI27 C7GRP2 C8Z9A2 E7KD15 E7LUY2 E7NI51 E7Q4B3 E7QF91 H0GGV3 N1P638 P22803
YGR209C 2hsy_A YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C SCRT_00812 YGR209C YGR209C tr|A6ZUM0|A6ZUM0_YEAS7 000162817|e2fa4A1|2485.1.1.40|A:8-111 000311154|e2fa4B1|2485.1.1.40|B:8-111 000316679|e2hsyA1|2485.1.1.40|A:1-104 cath|current|2hsyA00/1-104 d2fa4a_ d2fa4b_ d2hsya_ NP_011725.3.97178 YGR209C YGR209C YGR209C 4932.YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C YGR209C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]