SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL076W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL076W
Domain Number - Region: 38-115
Classification Level Classification E-value
Superfamily TPR-like 0.00177
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 
Domain Number - Region: 64-218
Classification Level Classification E-value
Superfamily HCP-like 0.00214
Family HCP-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIL076W
Sequence length 296
Comment SEC28 ORF Verified Epsilon-COP subunit of the coatomer; regulates retrograde Golgi-to-ER protein traffic; stabilizes Cop1p, the alpha-COP and the coatomer complex; non-essential for cell growth
Sequence
MDYFNIKQNYYTGNFVQCLQEIEKFSKVTDNTLLFYKAKTLLALGQYQSQDPTSKLGKVL
DLYVQFLDTKNIEELENLLKDKQNSPYELYLLATAQAILGDLDKSLETCVEGIDNDEAEG
TTELLLLAIEVALLNNNVSTASTIFDNYTNAIEDTVSGDNEMILNLAESYIKFATNKETA
TSNFYYYEELSQTFPTWKTQLGXLNLHLQQRNIXEAQGIVELLLSDYYSVEQKENAVLYK
PTFLANQITLALMQGLDTEDLTNQLVKLDHEHAFIKHHQEIDAKFDELVRKYDTSN
Download sequence
Identical sequences YIL076W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]