SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIR037W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR037W
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.65e-61
Family Glutathione peroxidase-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIR037W
Sequence length 163
Comment HYR1 ORF Verified Thiol peroxidase that functions as a hydroperoxide receptor to sense intracellular hydroperoxide levels and transduce a redox signal to the Yap1p transcription factor
Sequence
MSEFYKLAPVDKKGQPFPFDQLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTII
GFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGL
RGIKWNFEKFLVDKKGKVYERYSSLTKPSSLSETIEELLKEVE
Download sequence
Identical sequences A0A0L8VNX7 A0A250WMU8 A6ZVV7 B3LTH3 B5VKX4 C7GLR9 C8ZAU0 E7KQ13 E7Q599 E7QGA2 G2WFW5 H0GI49 N1P1U2 P40581
YIR037W SCRT_05142 NP_012303.1.97178 XP_015331937.1.40921 YIR037W YIR037W 4932.YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W YIR037W tr|A6ZVV7|A6ZVV7_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]