SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL082W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJL082W
Domain Number - Region: 170-269
Classification Level Classification E-value
Superfamily TPR-like 0.0003
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL082W
Sequence length 497
Comment IML2 ORF Verified Protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MRMGRLSGAHIGNTPSFHRLRDDLGLQTTPSQASDRHSVSDDFDLEQATIDEFIHSGANL
CYGILQVVLSLLPPAIGAVLSIVGFKGSREEGLRLVWKATKERNVHGCIGLLGLMFYYDG
PFQFTDADFDIPPNDNGSRALNKSRTNDSSLLPGYMDSATLLHPGKILEDALLKARALFP
NSALWLLNEAKMLAGKGRLRDSLALMDSIDVNSIRMRQVKSLMVFERAILLVNLHEYNRA
ADDLISLLDISDWSHALYTYFAGCCYLENWRMTQLGLLNDGKEQFYKERARELIFDAPSL
LGKKTFKSKNLPLDRFMLRKVQQFNNMQKKLNLQEPLDSIATSPVHELAYFYNGYNRMTE
NDLILTKKMLTEYHNPAIDSEDPDQELIRNLLLSLTLRRLGDAERGLALLDDIVLPKIFY
IQNGKVKYFKKTEDPWAYPAALYERALFCWKLGGMESLNECREWLLRAQNYAADYELSTR
IGMKIKAALDRVENALA
Download sequence
Identical sequences YJL082W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]