SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR117C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR117C
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000223
Family HAT/Suf repeat 0.021
Further Details:      
 
Domain Number 2 Region: 99-175
Classification Level Classification E-value
Superfamily TPR-like 0.000000000104
Family HAT/Suf repeat 0.029
Further Details:      
 
Domain Number 3 Region: 55-111
Classification Level Classification E-value
Superfamily TPR-like 0.000000000314
Family HAT/Suf repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR117C
Sequence length 374
Comment CLF1 ORF Verified Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs; homolog of Drosophila crooked neck protein; interacts with U1 snRNP proteins
Sequence
MDTLEPTAVDTHVSAEQILRDVYKKGQKARGSTNIDILDLEELREYQRRXRTEYEGYLKR
NRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARN
LMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQK
NWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSD
MEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPSNQLLKAGLLDFEKQFGDINSIEET
ISYKRKMEYXTILSNNAYDYDTWWLYLDLISESFPKQIMQTFEKAIVDSRPKELSKNXSV
EKVYLSVDEIYMLC
Download sequence
Identical sequences E7QHX6
YLR117C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]