SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR012W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR012W
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily TPR-like 0.0000000182
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR012W
Sequence length 289
Comment CLU1 ORF Verified eIF3 component of unknown function; deletion causes defects in mitochondrial organization but not in growth or translation initiation, can rescue cytokinesis and mitochondrial organization defects of the Dictyostelium cluA- mutant
Sequence
MINEDKQSALTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACT
IYERVSGIDSFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSI
FNHLEQLALGVQDTKLAIEVLGQLSSYVVELEGKDSLAYGYTESRLGNLFAALKDFHRAL
EHITVTQGIFTKQLGMNHTHSAQSRQWVNGLSSLIMDLKQKKQLAQDQMSTTGSNSAGHK
KTNHRQKKDDVKPELANKSVDELLTFIEGDSSNSKSKNKTNNKKKHGKK
Download sequence
Identical sequences YMR012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]