SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR251W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR251W
Domain Number 1 Region: 190-347
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.81e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 29-82,147-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000112
Family Glutathione S-transferase (GST), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR251W
Sequence length 366
Comment GTO3 ORF Verified Omega class glutathione transferase; putative cytosolic localization
Sequence
MSEKSASNNKAEFKRQSSPFREIISADHPIYKPAKGRYWLYVALPCPWAQRTLITRALKG
LAPIIGCSVAHWHLDDKGWRFLEEGDGKTNERHWFDIAGGISSVNLNTSTPVANIPNNAH
RLLVDGTDEPHYGYKRLSDFYFKTKPDYKGRFTVPVLWDLETCTIVNNESSDIIRIMNSA
AFDEFVGEEYRQVRLVPRSLEAQITEFNSWVYDKINNGVYKAGFAECAEVYEREVTSLFQ
YLDKLENLLDKKYTDLEAEYGKNNKDKILDRYFAIGDTLTEADVRLYPTIVRFDVVYHQH
FKCNLATIRDDYSRIHTWLKNIYWRHEAFQRTTDFTHIKLGYTRSQPRVNPIGITPLGPK
PDIRPP
Download sequence
Identical sequences A0A0L8VJ89 A6ZMW6 B3LMD9 B5VQ19 C7GRA1 C8ZFB6 E7LYY7 E7QIM9 H0GLF1
SCRT_02146 YMR251W tr|A6ZMW6|A6ZMW6_YEAS7 YMR251W YMR251W YMR251W YMR251W YMR251W YMR251W YMR251W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]