SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR281C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR281C
Domain Number 1 Region: 17-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.73e-38
Family Phosducin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR281C
Sequence length 261
Comment PLP2 ORF Verified Essential protein that interacts with the CCT (chaperonin containing TCP-1) complex to stimulate actin folding; has similarity to phosducins; null mutant lethality is complemented by mouse phosducin-like protein MgcPhLP
Sequence
MQNEPMFQVQVDESEDSEWNDILRAKGVIPERAPSPTAKLEEALEEAIAKQHENRLEDKD
LSDLEELEDDEDEDFLEAYKIKRLNEIRKLQERSKFGXVFHINKPEYNKEVTLASQGKKY
EGTQTNDNGEEDEGGVYVFVHLSLQSKLQSRVLSHLFQSAACKFREIKFVEIPANRAIEN
YPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDD
EESREERKLHYGXKKIDQVRY
Download sequence
Identical sequences E7QL04
YOR281C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]