SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR189W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR189W
Domain Number 1 Region: 369-521
Classification Level Classification E-value
Superfamily TPR-like 3.96e-24
Family Tetratricopeptide repeat (TPR) 0.0095
Further Details:      
 
Domain Number 2 Region: 675-800
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000176
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 219-394
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000386
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 4 Region: 857-1009
Classification Level Classification E-value
Superfamily TPR-like 0.0000000242
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPR189W
Sequence length 1163
Comment SKI3 ORF Verified Ski complex component and TPR protein, mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay
Sequence
MVEDMVLVNHQSLLAWQKYFEWTDYEDLDNMDAPLIIKYFKKFPKDPLAMILYSWLSSKL
SKYDIKSLESANKPPEGHKKTEKETDIKDVDETNEDEVKDRVEDEVKDRVEDEVKDQDEE
AKEDEEEDLDDIEIGLLEEEVVTVLTENIVKCKNNILAHRILCQYYLLTKEYEAALPYIK
NGISLIAYNIKDLGVHLPLTKREFSLDLATVYTYVDAPKDHNAALKLYDNILSGDFSNIQ
AKMGKGIIFIERKNWKDAMTLLTQVHEQSPNNLEVLSELSWSKAHMGYMDEALAGLDTVI
KGIKGMDLRSIDFRALNLWRQAKVYIMKHASINDAKQENVKCAFKLLIQSIKILDTFAPG
FSTLGDIYCHYYKDHLRAFKCYFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLI
KGEKAKAELRSNNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHAC
GRIEASIKVFDKAIQLRPSHTFAQYFKAISLCDVGEYLESLDILEKVCQEAATEESFQIG
LVEVLMRCSLDLYSQGFLLKSVSIAKDTIERIKIIITELKCENQQVWIYLSQVLRLFIWI
ESKVDTLPVESLVSIFENSQFSGSEEIDSVDNIKIDTLLDSTTDDNVSIACKFLILASKY
SVSDQKFTDIAGTVRASYWYNIGISELTAFITLKEPQYRDAAIFAFKKSIQLQSNTSETW
IGLGIATMDINFRVSQHCFIKATALEPKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLA
PQDSSPWLGMALILEEQGDIIGSSKLFAHSFILSNGRSKAAQFMYAKNVLENHINNGDDE
RDIETVEKLTTASIALEQFFKKSPDNQFALQCALLTLERLHHYENANELANRLIGILEKK
FEKTQDERELFNFAIIKGQFARIHLGLGNFELSIENADLSQGIISESSDEKSMKTKISNH
ICLGLSYFFLNDFDQTLNQFQELLSISKDSKHLVVLIAKVLYDVGESDTKEIALQELTEY
IATSGADLLVTLTIAAMSILDDKREDLSIILEELKALPLSKQIIDKHKDAPYLIEEITKR
LYRNDTGKQVWQRSAYFFPNNLKVWERLDKNIQRRIASNGQNKVTAEEMSKLYCESKNLR
SIQRGMFLCPWNVTAVKALNECF
Download sequence
Identical sequences YPR189W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]