SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR278W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR278W
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000184
Family TBP-associated factors, TAFs 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR278W
Sequence length 201
Comment DPB3 ORF Verified Third-largest subunit of DNA polymerase II (DNA polymerase epsilon), required to maintain fidelity of chromosomal replication and also for inheritance of telomeric silencing; mRNA abundance peaks at the G1/S boundary of the cell cycle
Sequence
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLVEESLVLAQLN
SKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSALDKKRELNMQPGRSDQEVVIE
EPELHEDDGVEEEEEEDEVSEEEEPVHNEELLDDSKDQQNDKSTRSVASLLSRFQYKSAL
DVGEHSDSSDIEVDHTKSTDP
Download sequence
Identical sequences A0A0L8VUU4 A0A250WGG4 A6ZLL6 B5VEM3 C7GMV4 D3UF25 E7K9M1 E7KKP0 E7LRS2 E7NF68 E7QBT4 G2W9T1 H0GCW9 N1P8N3 P27344
tr|A6ZLL6|A6ZLL6_YEAS7 YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W 4932.YBR278W YBR278W YBR278W YBR278W YBR278W NP_009837.1.97178 XP_015331865.1.40921 YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W YBR278W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]