SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL043C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL043C
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.86e-33
Family PDI-like 0.00000606
Further Details:      
 
Domain Number 2 Region: 366-498
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.37e-32
Family PDI-like 0.000000869
Further Details:      
 
Domain Number 3 Region: 142-239
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-29
Family PDI-like 0.00000285
Further Details:      
 
Domain Number 4 Region: 240-363
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.51e-25
Family PDI-like 0.000000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YCL043C
Sequence length 522
Comment PDI1 ORF Verified Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds
Sequence
MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPW
CGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSI
DYEGPRTAEAIVQFMIKQSQPAVAVATDLPAYLANETFVTPVIVQSGKIDADFNATFYSM
ANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPY
FGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR
HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEXFDELSDKIVLESKAIESLVKDFLKGD
ASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELA
DTYANATSDVLIAKLDHTENDVRGVXIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI
KENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL
Download sequence
Identical sequences E7QC03
YCL041C YCL043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]