SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR002W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR002W
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-49
Family Ran-binding domain 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR002W
Sequence length 201
Comment YRB1 ORF Verified Ran GTPase binding protein; involved in nuclear protein import and RNA export, ubiquitin-mediated protein degradation during the cell cycle; shuttles between the nucleus and cytoplasm; is essential; homolog of human RanBP1
Sequence
MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEEDTKEETKKEGDDAPES
PDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTN
KVRILMRRDKTLKIXANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGS
KENADKFKEEFEKAQEINKKA
Download sequence
Identical sequences YDR002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]