SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR104C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR104C
Domain Number 1 Region: 229-301,395-436
Classification Level Classification E-value
Superfamily PH domain-like 0.00000834
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Weak hits

Sequence:  YDR104C
Domain Number - Region: 133-178
Classification Level Classification E-value
Superfamily PH domain-like 0.0392
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number - Region: 27-119
Classification Level Classification E-value
Superfamily Api92-like 0.0432
Family Api92-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR104C
Sequence length 448
Comment SPO71 ORF Verified Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensable for both nuclear divisions during meiosis
Sequence
MKAYRANPPLPIDSMIDDTSTEIEKEEIWKQWKKIPEVYEQQPYPLDTNDHIEWMNCQTT
QSEYDSRDFYAFHCFHRRIDQILKTDNVIDLTEVKDIYQGTRTDYEADKIKYGVYKEASE
IFWHRNYEIDDVSRSVINIETSNGLLLKLLATSATVAEEWVIKLKQMISYWKNKQREDTE
RLLKIRRSNAGLLMLNGEEETKIGENTLRWIVEHGRADEQTFNANGISLSRPLIQKGPLY
QKPHKHSVFSKYYVVLISGFIVLFHCFHRSTTGFAKEVLEYAHYVTIPIDDCYLYSGTTT
ELDLLQRDRTFDEINYGSHALPRVYGDGWRSVEDESSRCFTLWFGTRRALSSNRLQKKGN
EKQYTQDYGRQDNNIDPPSAPEADLNNSNVPSNTDKIHFTKKLGVSGKSMVFMARSRQER
DLWVMSIYYELERLRRTASTSNSRNQTM
Download sequence
Identical sequences YDR104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]