SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR330W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR330W
Domain Number 1 Region: 199-342
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.13e-36
Family UAS domain 0.00013
Further Details:      
 
Domain Number 2 Region: 389-493
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-17
Family UBX domain 0.02
Further Details:      
 
Domain Number 3 Region: 4-44
Classification Level Classification E-value
Superfamily UBA-like 0.00000459
Family TAP-C domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR330W
Sequence length 500
Comment UBX5 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p
Sequence
MSEGKVDEFMAITGADXAAIATQFIEMADGNLNTAISLFFENGGAALLSSNNTPTPSNST
PMAPTSVDSDADAQLAERLQREAYQQQQPDQDYVRPPDEARHEVLTETSGFPISYGGIGG
RFEPLHRVNDMFDEGRPESIFNQRLDDTNTNTYINDNSSDSLDSEEENDDDEYEYVEEPV
IELDEDGNIKEYTKLVRKPKTISKEQKLALLFRPPFSIMSKLDLDAAKQKARAKQKWIMI
NIQDSGIFQCQALNRDLWSSRPVKTIIKENFVFLQYQYESRNAQPYLQFYHLNNKDDLPH
IAILDPITGERVKQWNRVVPIPEQFISEINEFLASFSLDPKVPNPTVNEPLPKVDPTTLT
EEQQMELAIKESLNNNSSKSNQEEVPSTGEEQKRVQEPDPFSTIEARVHPEPPNKPGITT
RIQIRTGDGSRLVRRFNALEDTVRTIYEVIKTEMDGFADSRFTLNDHQREDLIDKLNMTI
ADAGLKNSSLLLEKLDPEIE
Download sequence
Identical sequences YDR330W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]