SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER114C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER114C
Domain Number 1 Region: 337-455
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-23
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER114C
Sequence length 609
Comment BOI2 ORF Verified Protein implicated in polar growth, functionally redundant with Boi1p; interacts with bud-emergence protein Bem1p; contains an SH3 (src homology 3) domain and a PH (pleckstrin homology) domain
Sequence
MKICLFLRGEPPNPPSYPSPAQPPKSPLLNNTRTSPSPTQLYSWQSPTLSFSGPKRTSYI
DQYSSSDSNFNSRSALPKNNQGGGKALSPIPSPTRNSVRNEDSEGKLTSSSKRNSVPYYG
YAPESSSDRKSSCSSHEEEQFQETMNTFERPTSSIYADGSTIASISNDKLAHEKEGKKKP
TRHSSSLSSKSKSDSRRNSSLKRSSSASRTSSFKKSSFMLSPFRQQFTDNAARSSSPEEN
PITSMPSEKNSSPIVDKKSSKKSRSKRRSVSAKEAEIFTETVKDDKNKRSASEAIKGETL
KGKSLRQMTARPVAKKKQTSAFIEGLRSISVKEAMKDADFSGWMSKKGSGAMSTWKTRFF
TLHGTRLSYFSSTTDTRERGLIDITAHRVVPAKEDDKLVSLYAASTGKGRYCFKLLPPQP
GSKKGLTFTQPRTHYFAVDNKEEMRGWMAALIKTTIDIDTSVPIISSYTTPTVSLSKAQE
MLAEAREETKLREQQMLENEEDEDQFLWDQQQLQQQQHDNNQGQADRTISASTQRTSDED
NTISTPNLSSANNTTIGSNGFSSPFLLASGLLSPGVARNSSMRGTEKKGKFSTEEDYFRD
NSKHKTDKI
Download sequence
Identical sequences YER114C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]