SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR097W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR097W
Domain Number 1 Region: 274-319,388-412
Classification Level Classification E-value
Superfamily PH domain-like 0.0000016
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Weak hits

Sequence:  YGR097W
Domain Number - Region: 51-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.023
Family FCH domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGR097W
Sequence length 912
Comment ASK10 ORF Verified Component of RNA polymerase II holoenzyme, phosphorylated in response to oxidative stress; has a role in destruction of Ssn8p; proposed to function in activation of the glycerol channel Fps1p; paralogous to Rgc1p
Sequence
MQMQQEQQENAVQAPTDESKMSLAPHEYKPVQTTESDNTSAASGFVKFGSGSIQDIQVIL
KKYHLSLANQQFKISKEITSTVIPKLEELRKDLRYKITEIKDLHGDFKTNIGAHIQLTSQ
LLKKYIAAVKFMNAHGIGNDRASPTNKKPHKLDPKHDPYLLKLQLDLQLKRQVAEETYLQ
EAFINLQSSGLQLEKIIYTKIQHALLRYSALIDSEARLMIKNMCQELQHGIISKPPAFEW
DNFVTQHPSCLLNWKSNDPIPPPRKVSDVIYPHMKSPLAKCIKAGYFLKKSELLPTYHQG
YFVLTSNYIHEFQSSDFYNLSSSTPNSTKSSAYSSSVSIADTYANANNAKANNHHRQASD
VHNSSTTTGGTAGANGIRGIRKKSYLAPIMSIPLNDCTLKDASSTKFVLVGKPTLNENAD
VRKSSSSTYLSGSSQASLPKYGHETAKIFSKAPFHKFLKGSKPKNKNTKSSELDQFYAAA
QKESNNYVTWTFKIVSPEPSEEELKHFKRWVQDLKNLTSFNDTKDRIKFIEDRVMKSHRF
KAGHMSRNSVNIGSHTPCLTDSTFTLQDGTTTSVNLKGRAEKPQYIHIQNNSLADFDGNG
FRSKVNTPAIDDYGNLITVERRPAQSPHQYSDYMATSGNTTPSYSSGSRPQSMYNGYNPA
VSITSNGMMLQQSTANNNTNPTTNLRHQRNISQTSSLPGFSYTSLSLPVNSPGSSNSESS
SGGYFAIPLHGNNNNNNYTQRNSEGSSPCYNDDQIRQQQQPLQMQPLSRTSSSSVNVTAM
RSTSAGNSITANAPVVPKVMVNNQNVKTVAADQSATAPSSPTMNSSVTTINRESPYQTLK
KTNSTGNVPCLTAEKTHAHPAFYKRGNNSAQNLTTSSSTASRVHPIRKHKKNVSFSSLNS
LMFXKKGCKSRW
Download sequence
Identical sequences YGR097W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]