SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR073W-A from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR073W-A
Domain Number 1 Region: 124-220
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-19
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  YHR073W-A
Domain Number - Region: 48-94
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.00196
Family Supernatant protein factor (SPF), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YHR073W-A
Sequence length 570
Comment ORF Dubious Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verified ORF YHR073W; identified by expression profiling and mass spectrometry
Sequence
MDRIIRGKRDHILHCPLAAYSSNPRKIPLREKLSASGFTLVKRVGNVSGNTMVQGDLEVK
DTDYYYAFILDNSSSKNAKKKILFNASVINGDNQSMISTRSTPPARPTALSRTSTQQDML
FRVGQGRYLQGYLLKKRRKRLQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSV
SANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFDDQFEDKDTSTLEENPDILDD
DKEVINKSSPQDHDHLTPTATTKSALSHRQHTQKDMDDIYVPLPSESYATFSMNLRLIQQ
RLEQCKKDSLSYKPTTLHQRSEGLNGTHSSSSVFTNNRVSSFNHSSSGMTSSDSLASEEV
PSNKTYIEHALYNQLADLEVFVSRFVTQGEVLFKDHQILCKKAKDTRVSLTSYLSENDEF
FDAEEEISRGVIILPDTEDDINNIVEETPLLGKSDQNEFTKEVQLSGSEQIASSSVESYT
TNDENHSRKHLKNRHKNRRRGHPHHQKTKSAQSSTETFTSKDLFALSYPKSVTRRNDIPE
AAASPPSLLSFXEKECRQRSELYCHASNLK
Download sequence
Identical sequences YHR073W YHR073W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]