SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR189C from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR189C
Domain Number 1 Region: 232-360
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  YLR189C
Domain Number - Region: 591-635
Classification Level Classification E-value
Superfamily SspB-like 0.0883
Family Stringent starvation protein B, SspB 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR189C
Sequence length 657
Comment ATG26 ORF Verified UDP-glucose:sterol glucosyltransferase, conserved enzyme involved in synthesis of sterol glucoside membrane lipids; in contrast to ATG26 from P. pastoris, S. cerevisiae ATG26 is not involved in autophagy
Sequence
MPITQIISASDSEAGPKPSISLVPDKPSEPETSPRHHRLSRSLSKFKRWRGRSNSSLSMG
SSEQQELQDSPNEARSDDDENGYNNDNADDLAKSKYMMKSIAGLLTTASVYAGMNNAQEM
NVLSQVDSEESDSSDSFQENIGRNEVKSKKENLKTKSHPEVPRLDKRKPTLFDFSITREK
LSKDNVAKLRQRFCLDEREPFLNDFPAWLLKDVLVQGHIFITTKHFLFFAYLPKNPRSVK
MSGNLNIRTKLIRSTRYWCVLKNHLFSMYTSSTELYFPVLTIDLREVQKIETQKHTLNGS
ATKTFKLYTDESTFKFNADSEFSAKSWVNALKKEQFAAQNSENNSISLKIPLPNIIEIDD
QPIVNKALTLRLRALESSQTYAIDDFMFVFMDGSGSQVKESLGEQLAILQKSGVNTLYYD
IPAKKSKSSFGKETPATAEQKNNGEDSKYLNVPTSAVPSSENGKKSRFRFRERSNSWFRR
AKPLEDSQVEDVEEIYKDAANDIDSSVHSTIHIHEQEDSQEQTVAWKPSHLKNFAEMWAA
KPIHYRNKFIPFQKDDTYLIKETEEVSANERFRYHFKFNKEKSLISTYYTYLNRNVPVYG
KIYVSNDTVCFRSLLPGSNTYMVLPLVDVETCYKEKGFXFGYFVLVIVIHGHEELFF
Download sequence
Identical sequences YLR189C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]