SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML013W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YML013W
Domain Number - Region: 402-466
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000284
Family Ubiquitin-related 0.058
Further Details:      
 
Domain Number - Region: 14-60
Classification Level Classification E-value
Superfamily UBA-like 0.00408
Family TAP-C domain-like 0.035
Further Details:      
 
Domain Number - Region: 219-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0152
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YML013W
Sequence length 584
Comment UBX2 ORF Verified Protein involved in ER-associated protein degradation; proposed to coordinate the assembly of proteins involved in ERAD; contains a UBX (ubiquitin regulatory X) domain and a ubiquitin-associated (UBA) domain
Sequence
MPVVNHEDSEFHLSHTEEDKLNEFQVITNFPPXDLPDVVRLLRNHGWQLEPALSRYFDGE
WKGEPDQMGESTQTSTPMAETLVPPALGPRPLLFTASLPVVRPLPANFRNDFRTIGLNGR
SNTVWSMFESFSYDGNPFLFILLLIPRIINRLSATIFTFFCTLLSLHSISGGGNSGKPKI
SKVPKAPTRETHIPLAEILGDTKDKDAFCELKSFKPDISFNEALRIAKEEFKFMLLILVG
DTYDTDTDTVDVNSKLLLEKILLNKKTLQYLRKIDNDLIIYLKCVHELEPWLVARQLGVR
NTPEIFLIANVANKASHSETLPSQRLSILGKLKVNSLNRFLQSLTNVVEKYTPELVVNKT
EMHELRMSREIKKLQEDAYKKSLEMDRIKAIEKEKSLKHAQDLKLNSTARQLKWLKACID
EIQPFETXGKQATLQFRTSSGKRFVKKFPSMTTLYQIYQSIGCHIYLAVYSSDPVEWSNA
LQDKIRQLSADDDVLCFKEGQLETATATTIEELGHIINNELTSFDLERGKLEFDFELVSP
FPKYTVHPNEHMSVDQVPQLWPNGSLLVEALDEEDEEDEENEEQ
Download sequence
Identical sequences YML013W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]