SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML069W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML069W
Domain Number 1 Region: 237-474
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-83
Family SSRP1-like 0.000000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YML069W
Sequence length 552
Comment POB3 ORF Verified Subunit of the heterodimeric FACT complex (Spt16p-Pob3p), which associates with chromatin via interaction with Nhp6Ap and Nhp6Bp, and reorganizes nucleosomes to facilitate access to DNA by RNA and DNA polymerases
Sequence
MSTDFDRIYLNQSKFSGRFRIADSGLGWKISTSGGSAANQARKPFLLPATELSTVQWSRG
CRGYDLKINTKNQGVIQLDGFSQDDYNLIKNDFHRRFNIQVEQREHSLRGWNWGKTDLAR
NEMVFALNGKPTFEIPYARINNTNLTSKNEVGIEFNIQDEEYQPAGDELVEMRFYIPGVI
QTNVDENMTKKEESSNEVVPKKEDGAEGEDVQMAVEEKSMAEAFYEELKEKADIGEVAGD
AIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHLLVL
AIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHV
LKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMV
NISRAGQTSTSSRTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKNEDREVQ
ERLQTALGSDSDEEDINMGSAGEDDESVDEDFQVSSDNDADEVAEEFDSDAALSDAEGGS
DEERPSKKPKVE
Download sequence
Identical sequences A0A0L8VK31 A0A250WF21 A6ZLZ6 B3LLI6 B5VP62 C7GW05 C8ZED6 E7NL90 E7QIX5 G2WJY6 N1NYY8 Q04636
YML069W tr|A6ZLZ6|A6ZLZ6_YEAS7 YML069W YML069W YML069W YML069W 4932.YML069W YML069W YML069W SCRT_01829 YML069W YML069W YML069W NP_013642.1.97178 YML069W YML069W YML069W YML069W YML069W 354964 CX00027 YT713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]