SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL278W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL278W
Domain Number 1 Region: 77-214
Classification Level Classification E-value
Superfamily PH domain-like 0.00000177
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  YNL278W
Domain Number - Region: 699-759
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0523
Family Phase 1 flagellin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL278W
Sequence length 1060
Comment CAF120 ORF Verified Part of the evolutionarily-conserved CCR4-NOT transcriptional regulatory complex involved in controlling mRNA initiation, elongation, and degradation
Sequence
MRIFSGDNKVVDSLASNPGLMSPSNFGGDFGSRLKVNVTSKKKLNDSSPTSPMESSPVSP
ELVPILTLLNAHTHRRYHEGVFLILQDLNNNGTHAARKWKDVYGVLLGTQLALWDAKELA
EFTDPSCPVSEKKLKEVASKPTYINLTDATLRTLDNSDNIVMECGKNLTNALVVSTTLKN
RYFLQFGNKESFNAWNSAIRLCLYECSSLQEAYTGAFISSRGAKLGDIRILLTNRKYDYK
DWVSVRFGAGMPWKRCYAVISQSSSKKKGHFGEINLYENDKKVKKNHAMATIVEAKALYA
VYPSSPKLIDSSTIIKVVGSVKFEKKESAQEKDVFIMPEKHQAVPSYDTIIRFLIPAMDT
FKLYGRPEKLLSSKNDPHSLLFGLPVLPHIYYLEVEDLLPLTNSVSSLHWSNNEWKEHIS
DILQRKIAQGYCGCNSTSNITSPLPSPFLGSADLFERADGVLSPKLSYGSKSSSNNSSKN
SLPKRERVKLSSSSEQDLNNSDSPSIKRKSPPLVISESPHKVHTPTDASFRTRVTEGSPY
AKQRHPKPFASSVNDSPSDRAKSRTVPYNNNDRKATTPEKFERGETSCGKNVDESLEKVR
NMKLEIPESNFDKFMTDKNLLSVDSKCSNEKKLSVESDLSAIYEKYSNGPFGHTEGLNGS
SDETYLRFQRASVHSESNYNSRKSFTPSDFSNGNEEEHAVLQELNSLTQRINELGMESIN
SNSDSDRINGSYSQVDFGNNNDEDDMNLFDPDFMAQDQLRAEERDYNKDDRTPLAKVPAA
FQSTGLGITPDDDIERQYITEHRSRHEVPKRSPEKPSNPLEIGNPYAKPGTRLNTTHTHS
KTDRSITPQRGQPVPSGQQISSYVQPANINSPNKMYGANNSAMGSPRNPKTRAPPGPYNQ
GWNNRPSPSNIYQRPHPSDTQPQAYHLPGNPYSTGNRPNMQAQYHPQQVPMPIPQQPNRP
YQPYAMNTHMGSPGGYAGAAPPFQPANVNYNTRPQQPWPTPNSPSAHYRPPPNLNQPQNG
SAGYYRPPAPQLQNSQARPQKKDGFSQFMPSATTKNPYAQ
Download sequence
Identical sequences A0A0L8VI63 E7QJL0
YNL278W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]