SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL268W from Saccharomyces cerevisiae VL3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL268W
Domain Number 1 Region: 384-551
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.1e-57
Family Mammalian PLC 0.0000484
Further Details:      
 
Domain Number 2 Region: 252-369
Classification Level Classification E-value
Superfamily EF-hand 7.72e-21
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 102-213
Classification Level Classification E-value
Superfamily PH domain-like 0.000000016
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL268W
Sequence length 555
Comment PLC1 ORF Verified Phospholipase C, hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes
Sequence
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV
RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR
RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDXASTYQEEVDPKRLRSDSKLWI
TIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT
VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI
LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG
QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG
CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ
KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS
SSYESANEQELRMKR
Download sequence
Identical sequences YPL268W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]