SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAL003W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL003W
Domain Number 1 Region: 118-206
Classification Level Classification E-value
Superfamily eEF-1beta-like 5.49e-33
Family eEF-1beta-like 0.00000295
Further Details:      
 
Domain Number 2 Region: 9-58
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000237
Family Glutathione S-transferase (GST), C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YAL003W
Sequence length 206
Comment EFB1 ORF Verified Translation elongation factor 1 beta; stimulates nucleotide exchange to regenerate EF-1 alpha-GTP for the next elongation cycle; part of the EF-1 complex, which facilitates binding of aminoacyl-tRNA to the ribosomal A site
Sequence
MASTDFSKIETLKQLNASLADKSYIEGTAVSQADVTVFKAFQSAYPEFSRWFNHIASKAD
EFDSFPAASAAAAEEEEDDDVDLFGSDDEEADAEAEKLKAERIAAYNAKKAAKPAKPAAK
SIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVS
LDDLQQSIEEDEDHVQSTDIAAMQKL
Download sequence
Identical sequences N1P7L5 P32471
NP_009398.1.97178 YAL003W 4932.YAL003W YAL003W YAL003w___KOG1668 YAL003W YAL003W YAL003W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]