SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR024W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR024W
Domain Number 1 Region: 122-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-52
Family Glutathione peroxidase-like 0.000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR024W
Sequence length 301
Comment SCO2 ORF Verified Protein anchored to the mitochondrial inner membrane, similar to Sco1p and may have a redundant function with Sco1p in delivery of copper to cytochrome c oxidase; interacts with Cox2p
Sequence
MLNSSRKYACRSLFRQANVSIKGLFYNGGAYRRGFSTGCCLRSDNKESPSARQPLDRLQL
GDEINEPEPIRTRFFQFSRWKATIALLLLSGGTYAYLSRKRRLLETEKEADANRAYGSVA
LGGPFNLTDFNGKPFTEENLKGKFSILYFGFSHCPDICPEELDRLTYWISELDDKDHIKI
QPLFISCDPARDTPDVLKEYLSDFHPAIIGLTGTYDQVKSVCKKYKVYFSTPRDVKPNQD
YLVDHSIFFYLIDPEGQFIDALGRNYDEQSGLEKIREQIQAYVPKEERERRSKKWYSFIF
N
Download sequence
Identical sequences A0A0L8VV77 A6ZKX0 B5VDZ4 C7GM28 C8Z418 E7KK63 E7LR56 E7NER8 P38072
NP_009580.1.97178 YBR024W YBR024W YBR024W 4932.YBR024W YBR024W YBR024W YBR024W YBR024W tr|A6ZKX0|A6ZKX0_YEAS7 YBR024W YT154 YBR024W YBR024W YBR024W YBR024W YBR024W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]