SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR055C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR055C
Domain Number 1 Region: 219-286
Classification Level Classification E-value
Superfamily TPR-like 0.00000296
Family HAT/Suf repeat 0.059
Further Details:      
 
Domain Number 2 Region: 299-615
Classification Level Classification E-value
Superfamily TPR-like 0.00000326
Family HAT/Suf repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR055C
Sequence length 627
Comment PRP6 ORF Verified Splicing factor, component of the U4/U6-U5 snRNP complex
Sequence
MERPSFLDQEPPAGYVPGIGRGATGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPK
DDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWM
DIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQ
LTKNASNPIQVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTN
PQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDVHYCKTLVATAI
NFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEK
ATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTLLEERNNPDIPVDK
LVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYES
ELNNVDQILEKMPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELL
FQTKNSDDIRANMREKSPGLLMMYVSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFK
IKLLGRSLQLDELRDFFSANFLLFRGF
Download sequence
Identical sequences YBR055C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]