SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR183W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR183W
Domain Number 1 Region: 25-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.4e-33
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR183W
Sequence length 230
Comment PLP1 ORF Verified Protein that interacts with CCT (chaperonin containing TCP-1) complex and has a role in actin and tubulin folding; has weak similarity to phosducins, which are G-protein regulators
Sequence
MEDKLDRYYTNVLSNAEKDKHTTVDSDDKSSGEENLDELLNELDRELDEDHEFLSAYRSE
RLQQISDHLKQVKKNVEDDGYGRLQCIDNEADAIQICTKTTMVVIHFELETFGKCQYMNE
KLENLAKRYLTTRFIKVNVQTCPFLVNKLNIKVLPFVVGYKNGLEKVRYVGFSKLGNDPN
GFDIRRLEQSLAHSGVIEDTFEIRKHSSVNTERFASTNHDRSESDSDLDI
Download sequence
Identical sequences A0A0L8VTG3 A0A250W8Y9 A6ZYE3 B3LG98 B5VG77 C8Z597 E7KLQ8 E7LSV4 E7Q293 E7QCZ3 G2WAT3 H0GDK4 Q04004
NP_010469.3.97178 YDR183W 4932.YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W SCRT_00336 YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W YDR183W tr|A6ZYE3|A6ZYE3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]