SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR263C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR263C
Domain Number 1 Region: 3-227
Classification Level Classification E-value
Superfamily PIN domain-like 2.35e-61
Family 5' to 3' exonuclease catalytic domain 0.00078
Further Details:      
 
Domain Number 2 Region: 212-305
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.48e-16
Family 5' to 3' exonuclease, C-terminal subdomain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR263C
Sequence length 430
Comment DIN7 ORF Verified Mitochondrial nuclease functioning in DNA repair and replication, modulates the stability of the mitochondrial genome, induced by exposure to mutagens, also induced during meiosis at a time nearly coincident with commitment to recombination
Sequence
MGIPGLLPQLKRIQKQVSLKKYMYQTLAIDGYAWLHRASCACAFELVMNKPTNKYLQFFI
KRLQLLKRLKIKPYIVFDGDSLFVKNHTETRRRKKRLENEMIAKKLWSAGNRYNAMEYFQ
KSVDITPEMAKCIIDYCKLHSIPYIVAPFEADPQMVYLEKMGLIQGIISEDSDLLVFGCK
TLITKLNDQGKALEISKDDFSALPENFPLGELSEQQFRNLVCLAGCDYTSGIWKVGVVTA
MKIVKRYSEMKDILIQIERTEKLCFSKAFKQQVEFANYAFQYQRVFCPLSNQITTLNNIP
KAVTNSHAEIIKIMKCIGSVVERGSGVRKDVINTKNIDHKVHEMIAKGELHPVDMASKLI
NRERKLKARKLFKVGLLGGESNSFNKKVEQPLVDTQDVLSERENSLDNKNASSIYMTSPA
AISGTVPSIF
Download sequence
Identical sequences A0A0L8VTM4 A6ZYL6 B3LG27 C8Z5H6 H0GEA0 N1PAG6 Q12086
YDR263C YDR263C tr|A6ZYL6|A6ZYL6_YEAS7 YDR263C YDR263C SCRT_00262 YDR263C NP_010549.3.97178 YDR263C YDR263C 4932.YDR263C YDR263C YDR263C YDR263C YDR263C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]