SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR339C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR339C
Domain Number 1 Region: 61-185
Classification Level Classification E-value
Superfamily PIN domain-like 2.07e-30
Family PIN domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR339C
Sequence length 189
Comment FCF1 ORF Verified Putative PINc domain nuclease required for early cleavages of 35S pre-rRNA and maturation of 18S rRNA; component of the SSU (small subunit) processome involved in 40S ribosomal subunit biogenesis; copurifies with Faf1p
Sequence
MGKAKKTRKFGLVKRTLNTKKDQRLKKNQENIKTKEDPELTRNIPQVSSALFFQYNQAIK
PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLA
RDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAY
VIEKLPDVF
Download sequence
Identical sequences A0A0L8VTM1 B3LFV8 B5VGM2 C7GWN6 C8Z5Q1 N1PAI2 Q05498
YDR339C YDR339C YDR339C YDR339C YDR339C YDR339C YDR339C YDR339C NP_010626.1.97178 YDR339C YDR339C 5wlc_SL 5wyj_U4 5wyk_U4 4932.YDR339C SCRT_00190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]