SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER041W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER041W
Domain Number 1 Region: 2-230,267-288
Classification Level Classification E-value
Superfamily PIN domain-like 4.91e-38
Family 5' to 3' exonuclease catalytic domain 0.0011
Further Details:      
 
Domain Number 2 Region: 274-315,369-437
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.00000000179
Family 5' to 3' exonuclease, C-terminal subdomain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YER041W
Sequence length 759
Comment YEN1 ORF Verified Holliday junction resolvase; localization is cell-cycle dependent and regulated by Cdc28p phosphorylation; homolog of human GEN1 and has similarity to S. cerevisiae endonuclease Rth1p
Sequence
MGVSQIWEFLKPYLQDSRIPLRKFVIDFNKSQKRAPRIAIDAYGWLFECGFIQNIDISAR
SRSRSRSPTRSPRDSDIDSSQEYYGSRSYTTTGKAVINFISRLKELLSLNVEFLLVFDGV
MKPSFKRKFNHEQNATTCDDEKEYYSSWEQHVKNHEVYGNCKGLLAPSDPEFISLVRKLL
DLMNISYVIACGEGEAQCVWLQVSGAVDFILSNDSDTLVFGGEKILKNYSKFYDDFGPSS
ITSHSPSRHHDSKESFVTVIDLPKINKVAGKKFDRLSLLFFSVLLGADYNRGVKGLGKNK
SLQLAQCEDPNFSMEFYDIFKDFNLEDLTSESLRKSRYRLFQKRLYLYCKDHSVELFGRN
YPVLLNQGSFEGWPSTVAIMHYFHPIVQPYFDEEVLSDKYINMAGNGHYRNLNFNELKYF
LQSLNLPQISSFDKWFHDSMHEMFLLREFLSIDESDNIGKGNMRITEEKIMNIDGGKFQI
PCFKIRYTTFLPNIPISSQSPLKRSNSPSRSKSPTRRQMDIMEHPNSLWLPKYLIPQSHP
LVIQYYETQQLIQKEKEKKGKKSNKSRLPQKNNLDEFLRKHTSPIKSIGKVGESRKEILE
PVRKRLFVDTDEDTSLEEIPAPTRLTTVDEHSDNDDDSLIFVDEITNSQSVLDSSPGKRI
RDLTQDEQVDVWKDVIEISPIKKSRTTNAEKNPPESGLKSRSSITINARLQGTKMLPPNL
TAPRLEREHSSVLDQLVTDAQDTVDRFVACDSDSSSTIE
Download sequence
Identical sequences P40028
YER041W YER041W YER041W NP_010959.2.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]