SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER048C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER048C
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-29
Family Chaperone J-domain 0.00043
Further Details:      
 
Weak hits

Sequence:  YER048C
Domain Number - Region: 159-218
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0471
Family Apolipoprotein 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YER048C
Sequence length 391
Comment CAJ1 ORF Verified Nuclear type II J heat shock protein of the E. coli dnaJ family, contains a leucine zipper-like motif, binds to non-native substrates for presentation to Ssa3p, may function during protein translocation, assembly and disassembly
Sequence
MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD
PGLRSKYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDWIGEFSLFKELNEATEMFGKE
DEEGTAATETEKADESTDGGMVKHDTNKAESLKKDKLSKEQREKLMEMEKKRREDMMKQV
DELAEKLNEKISRYLIAVKSNNLEEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANN
FIMSKKTYGISKIFTGTRDNARSVKSAYNLLSTGLEAQKAMEKMSEVNTDELDQYERAKF
ESTMAGKALGVMWAMSKFELERKLKDVCNKILNDKKVPSKERIAKAKAMLFIAHKFASAR
RSPEEAEEARVFEELILGEQEKEHKKHTVAR
Download sequence
Identical sequences A0A0L8VS08 A0A250WJB9 A6ZQZ8 B3LS61 B5VHI0 C7GSJ6 E7QDV5 G2WCT2 N1P4U2 P39101
YER048C YER048C YER048C YER048C tr|A6ZQZ8|A6ZQZ8_YEAS7 YER048C 4932.YER048C YER048C YER048C YER048C NP_010967.3.97178 YER048C APC90057 YER048C SCRT_04520 YER048C YER048C YER048C YER048C YER048C YER048C YER048C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]