SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFL016C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFL016C
Domain Number 1 Region: 57-160
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-30
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 220-295
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.01e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00025
Further Details:      
 
Domain Number 3 Region: 361-440
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000445
Family HSP40/DnaJ peptide-binding domain 0.0032
Further Details:      
 
Domain Number 4 Region: 195-220,269-360
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000131
Family HSP40/DnaJ peptide-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YFL016C
Sequence length 519
Comment MDJ1 ORF Verified Co-chaperone that stimulates the ATPase activity of the HSP70 protein Ssc1p; involved in protein folding/refolding in the mitochodrial matrix; required for proteolysis of misfolded proteins; member of the HSP40 (DnaJ) family of chaperones
Sequence
MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHTSAIRNNEAFK
DPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEKKFHDLQNAYEILSDETKRQQ
YDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGAAFGGG
GRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKP
NTHKVSCSTCHGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT
ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVDKDPNFSIKNK
YDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQYNQVISIPNMGVPKTSTIRGD
MKVQYKIVVKKPQSLAEKCLWEALADVTNDDMAKKTMQPGTAAGTAINEEILKKQKQEEE
KHAKKDDDNTLKRLENFITNTFRKIKGDKKIKLHAISCR
Download sequence
Identical sequences YFL016C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]