SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIR038C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR038C
Domain Number 1 Region: 101-226
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000209
Family Glutathione S-transferase (GST), C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000385
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIR038C
Sequence length 234
Comment GTT1 ORF Verified ER associated glutathione S-transferase capable of homodimerization; expression induced during the diauxic shift and throughout stationary phase; functional overlap with Gtt2p, Grx1p, and Grx2p
Sequence
MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLE
VQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMI
EFILSKVKDSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLS
GADILMSFPLQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARALGSNF
Download sequence
Identical sequences A0A0L8VNZ4 A0A250WN71 A6ZVV8 C7GLR8 E7KE00 E7QGA3 G2WFW6 N1P0S6 P40582
YIR038C tr|A6ZVV8|A6ZVV8_YEAS7 YIR038C YIR038C YIR038C YIR038C YIR038C 355072 YIR038C YIR038C YIR038C YIR038C 4932.YIR038C YIR038C YIR038C NP_012304.1.97178 YIR038C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]