SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL162C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL162C
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-18
Family Chaperone J-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YJL162C
Sequence length 583
Comment JJJ2 ORF Verified Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein
Sequence
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHA
HSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKP
YEQQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDIDSLFHETN
GASKVRMTDAGKMDTNSQFQEIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQ
QQQQQQQQQQQQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSANEGWNILRDI
IEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIKEPKGMKRRKKDDISLEELFQ
SLPREKDYFMMDAINDSLESINLFKKPKTTQSHEQGGTFAQAESNRAKFKPLLEQCGITP
EILDLEIPEIPEFDAVADLETLKLNVQLFNNQCNKLKETIHQVSLQRLRADTQFSDMLTQ
KQSIMVWKTYLEFDKSLMDKLNILQERQMQVIKIFSERCDGKV
Download sequence
Identical sequences C7GRZ0 P46997
YJL162C YJL162C YJL162C YJL162C NP_012373.2.97178 YJL162C 4932.YJL162C YJL162C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]