SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR097W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR097W
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.24e-20
Family Chaperone J-domain 0.0014
Further Details:      
 
Domain Number 2 Region: 90-170
Classification Level Classification E-value
Superfamily CSL zinc finger 0.00000000000017
Family CSL zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJR097W
Sequence length 172
Comment JJJ3 ORF Verified Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein
Sequence
MSLVNSLTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAY
KILSNIKTRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVG
GFHFSESLLDECIDNVDAMERSHSGYQLLTQCSACSLWLKVNFDIEEEQEGQ
Download sequence
Identical sequences A0A0L8VNF1 B3LQI2 B5VLP3 C7GMB0 C8ZBP4 E7KQL7 E7LWG8 E7NJH4 E7Q5R3 H0GIU5 N1P8U0 P47138
SCRT_03748 YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W YJR097W APC90049 YJR097W YJR097W YJR097W YJR097W 4932.YJR097W NP_012631.3.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]