SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL081W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL081W
Domain Number 1 Region: 251-412
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.31e-67
Family eEF1-gamma domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 68-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000484
Family Glutathione S-transferase (GST), N-terminal domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKL081W
Sequence length 412
Comment TEF4 ORF Verified Gamma subunit of translational elongation factor eEF1B, stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing eEF1A (Tef1p/Tef2p) from the ribosomal complex
Sequence
MSQGTLYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLT
EALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIP
YNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRA
KHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKKDEAK
PADDAAPAKKPKHPLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVG
YKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPA
FDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK
Download sequence
Identical sequences A0A0L8VMB0 B3LR10 N1P2A1 P36008
YKL081W NP_012842.1.97178 SCRT_03940 YKL081W YKL081W YKL081W YKL081W YKL081W YKL081W YKL081W YKL081W 4932.YKL081W YKL081W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]