SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL167C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YKL167C
Domain Number - Region: 39-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000604
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKL167C
Sequence length 137
Comment MRP49 ORF Verified Mitochondrial ribosomal protein of the large subunit, not essential for mitochondrial translation
Sequence
MSKVAQQLKFLNKISATTRLPQILVDPKKYSGLRLTFQTKNHNGHMGARVFWHNYLPTLQ
FYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEGSVVETIDMRNKMHEDIMKDLLDKIEHV
PLPENEIIRVRPQESII
Download sequence
Identical sequences A0A0L8VM83 B3LQT7 C7GJ40 C8ZC06 E7KQV8 E7LWP2 E7NJT6 H0GJL1
YKL167C YKL167C YKL167C SCRT_03861 YKL167C YKL167C YKL167C YKL167C YKL167C YKL167C YKL167C YKL167C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]