SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKR018C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR018C
Domain Number 1 Region: 399-498
Classification Level Classification E-value
Superfamily TPR-like 0.000024
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 
Weak hits

Sequence:  YKR018C
Domain Number - Region: 514-580
Classification Level Classification E-value
Superfamily Histone-fold 0.0795
Family Bacterial histone-fold protein 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YKR018C
Sequence length 725
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus
Sequence
MFKVFGFGAKEEIPELSQEEKTKAILKQAHDFEQALRAMDYVLDDNADEGLALLDESDAK
EASDQTINALARGVIEFLEATLGFEAEEMKKASATLAKAEALSLKSRERAQKIGLKSSSL
YPPGTVYAVTYTESCLLHALLMIFSESMMEAAKAILKLRKSYYMLQEILETIKAANKAKK
LKITSGSEDKESTPATFITGGDAFNSVDIPYELTPEEQKDKDLLQFAEQIHSMRTKRLSG
AHIGNSPAINRLRGELGLQAMEDLPEEEITDHKVLSDDIDLSQATIDEFVHSGVNLCFGI
LQVVISLLPPAIGAVLSVVGFRGSREEGLRLVWKATKQRNVHGCIGLLALMFYYDGPFQF
TDDDFDIPAAVKDSSNSEDSEDEEMDGPTLLHPGKILEDALLQSRALFPNSALWLLNEAR
MLSGKGRLEEAVALMDSIDVSKIRMRQVKSLMIFDRAITLIHLHQYDRAAEDILSLLDIS
DWSHAFYTYFAGCCYLENWRMCEMGLMKSDKKDEYQKKAEELIFTSVNLLGKKTFKSKNL
PLDRFILRKVEQFKAKKEELGVENPLDGIATSPVHEISYFYNGYNRMSEEHLELTKKMLT
EYRNPAIEALDSDQELIKDLLVSLTLRRLGHIQEGCDILDEKVLPKFFSIQNGKVKYIKK
TEDPWAYPTALYERALFTWKLEGMDGLPESKEWLLRAQGYADDYELSTRVGMKIKAAIDR
VDHSL
Download sequence
Identical sequences A6ZZY2 B3LRA2
YKR018C sp|A6ZZY2|YKR18_YEAS7 SCRT_04038 YKR018C YKR018C YKR018C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]