SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLL060C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL060C
Domain Number 1 Region: 22-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-28
Family SCOPe 0.041
Further Details:      
 
Domain Number 2 Region: 102-227
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.08e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.087
Further Details:      
 
Domain Number 3 Region: 58-108
Classification Level Classification E-value
Superfamily PDB 0.000086
Family PDB 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLL060C
Sequence length 233
Comment GTT2 ORF Verified Glutathione S-transferase capable of homodimerization; functional overlap with Gtt2p, Grx1p, and Grx2p
Sequence
MNGRGFLIYNGGEKMKQKMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKK
PEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVIHMMNKRA
ELELLDPVSVYFHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDS
FSMADITVIAGLIFAAIVKLQVPEECEALRAWYKRMQQRPSVKKLLEIRSKSS
Download sequence
Identical sequences G2WIE1 Q12390
YLL060C NP_013040.1.97178 YLL060C YLL060C YLL060C YLL060C YLL060C YLL060C 4932.YLL060C 3erf_A 3erg_A 3erg_B 3ibh_A YLL060C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]