SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR012W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR012W
Domain Number 1 Region: 211-302
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.00000000109
Family Hypothetical protein c14orf129, hspc210 0.025
Further Details:      
 
Domain Number 2 Region: 993-1125
Classification Level Classification E-value
Superfamily TPR-like 0.000000197
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 
Weak hits

Sequence:  YMR012W
Domain Number - Region: 12-56
Classification Level Classification E-value
Superfamily Lipocalins 0.0542
Family Fatty acid binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR012W
Sequence length 1277
Comment CLU1 ORF Verified eIF3 component of unknown function; deletion causes defects in mitochondrial organization but not in growth or translation initiation, can rescue cytokinesis and mitochondrial organization defects of the Dictyostelium cluA- mutant
Sequence
MSEKKEEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVL
AMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKSELKLQLILKPYSAREALKHVITV
RDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERSKQEEKDEKSDPEEKKNTFKDVTD
EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY
LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK
KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN
FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD
QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE
FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF
DSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFDKRRYILDLANTYPLDINFARQNF
DNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEFEKAYEENLFSYNPDAYQVEGIED
ANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKIIELSQKE
LDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKEVPKELTE
DLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVPVFLVPSL
VAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRFRHQLPSN
WIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVEPPTTFSL
SDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNNILHPAVA
EKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEFSNESPYN
ATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLSSYVVELE
GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSRQWVNGLS
SLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLTFIEGDSS
NSKSKNKTNNKKKHGKK
Download sequence
Identical sequences N1NYL3 Q03690
YMR012W 4932.YMR012W YMR012W YMR012W YMR012W NP_013725.1.97178 YMR012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]