SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR161W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR161W
Domain Number 1 Region: 17-119
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-28
Family Chaperone J-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR161W
Sequence length 224
Comment HLJ1 ORF Verified Co-chaperone for Hsp40p, anchored in the ER membrane; with its homolog Ydj1p promotes ER-associated protein degradation (ERAD) of integral membrane substrates; similar to E. coli DnaJ
Sequence
MSFTEDQEKIALEILSKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE
AFKVINRAFEVLSNEEKRSIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFF
NSRFGGQRAGPPEDIFDFLFNAGGSPFGASPFGPSASTFSFGGPGGFRVYTNNRGGSPFM
RQQPRSRQQQQQAEENAVNSQLKNMLVLFIIFIVLPMIKDYLFS
Download sequence
Identical sequences A0A250WEG0 A6ZMM0 B3LM49 B5VPT1 C7GU61 C8ZF21 E7KGU0 E7KSR9 E7LYT1 E7Q7W7 E7QJD9 G2WKL4 H0GL75 N1NXG1 P48353
YMR161W YMR161W YMR161W YMR161W 4932.YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W SCRT_02052 YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W YMR161W tr|A6ZMM0|A6ZMM0_YEAS7 YMR161W NP_013884.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]