SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR218C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR218C
Domain Number - Region: 434-463
Classification Level Classification E-value
Superfamily TPR-like 0.0921
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR218C
Sequence length 1102
Comment TRS130 ORF Verified One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion; involved in ER to Golgi membrane traffic; mutation activates transcription of OCH1
Sequence
MDKEIYCGSVPVSYFDPFDLFESLRPEFQQILPLDNIHWKAFDGTVRTVNRLPIELIPEG
RGEADKSNDEQPFIRFLIVNCISIDQYRAKVRPLVRQWLPNLESVSSSTGEKMIYKPIIL
LYANSEVVDSNLFKSVSLMEKFGKDFPHVQTLEVRSVYRSPKERQEFWNQFSQKIKASVL
SIFQKRLTHLQHSLANLQKGNNFEEQLLTREKLYELYVVFNILEDASLELQKIKKEILRR
NMNMPDGKLQVPFESSSKSDESLGSIIIEGTLDKFQLHKYFFIRRLRLLKLEDQTLTAFV
GAFQLIKNFIESISIEYRKSVRLLEFKHYFITSMLSYFEFENVSNPLLCEIKAELLMLKR
DNWVQGVMATSGYRLMDKNYPNSDVKYKFDLLKETFVDETVFQENFLTLTKEILSLFNKC
EGKRQRIVDILSIEIGLLYYQGKKYEEAVSLFLSCYEYYTQTNWNSIGLKILQVFIDSLS
HCPKLDVLQIDGESVSASAVLTNAFLNILKLCKDNDSKEIWWKKFMDLQMKNNIHLMYPL
DGLFEVTLNSKVHLARANVSAIEVNLKSYGFPEDISTKTMRLSLKNMGGDVIVFGASDFL
LKKGENKLILECRDIMYGEFSLLSFEIIVEGITFVKEFPENQDEFIVVPEIYCKESTKVL
VKQAHNLNLGEYALELKSVQSDALESLQVEVEVQKNIGNMKNLPVSFSMDEIQARKRYNT
PFENVRLEYYLLDQITAFDLIIKTSFTKKNDQGTFGETKKVRIQCYLQLSVSVEDIFKKD
IFFFKFLLNSSVREEPVILYSSELSAPDTRNDYNIRGDYIATTPALITFDGNESFINCYE
ITANNNFDSKDIFNLKVRYNTLKEQLDCFITDAVLIEGDVEWFILFEKWKTFWELEILKK
LKYDYDAFKENRIIRLLKTSIDLNKTKSKIRNLCIEKAVLDKILICLNKVSRGIAVCNTD
MDEYVRNLVPKQLTVPVQLPGFEQFFHVQFEQMETSHDALHDTIATIGNSLSYTVIVENL
SGQWGQDVIDDGGYIFEILSSNEWLIHGQKRCAIKEKRKEFEVHLIPLKKGYLNFPRVEI
TNINGKSCRVDHSNAFESILIF
Download sequence
Identical sequences Q03660
NP_013945.1.97178 4932.YMR218C YMR218C YMR218C YMR218C YMR218C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]