SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR229C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR229C
Domain Number 1 Region: 1503-1724
Classification Level Classification E-value
Superfamily TPR-like 1.21e-37
Family HAT/Suf repeat 0.037
Further Details:      
 
Domain Number 2 Region: 1260-1336
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.72e-28
Family Cold shock DNA-binding domain-like 0.063
Further Details:      
 
Domain Number 3 Region: 1173-1245
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.27e-22
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 
Domain Number 4 Region: 607-676
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.91e-17
Family SCOPe 0.077
Further Details:      
 
Domain Number 5 Region: 889-959
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000202
Family Cold shock DNA-binding domain-like 0.03
Further Details:      
 
Domain Number 6 Region: 798-864
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000036
Family Cold shock DNA-binding domain-like 0.018
Further Details:      
 
Domain Number 7 Region: 506-580
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000234
Family SCOPe 0.083
Further Details:      
 
Domain Number 8 Region: 1085-1159
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000159
Family Cold shock DNA-binding domain-like 0.044
Further Details:      
 
Domain Number 9 Region: 114-153,199-240
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000414
Family SCOPe 0.026
Further Details:      
 
Domain Number 10 Region: 690-769
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000534
Family SCOPe 0.088
Further Details:      
 
Domain Number 11 Region: 998-1068
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000012
Family Cold shock DNA-binding domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR229C
Sequence length 1729
Comment RRP5 ORF Verified RNA binding protein with preference for single stranded tracts of U's involved in synthesis of both 18S and 5.8S rRNAs; component of both the ribosomal small subunit (SSU) processosome and the 90S preribosome
Sequence
MVASTKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAAS
DVLFGNESVKASEPASRPLKKKKTTKKSTSKDSEASSANSDEARAGLIEHVNFKTLKNGS
SLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKV
EDAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTI
EPSSVNIYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAV
FLGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGL
VSGVVNVSHLRTFSEEDLKHKFVIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDAL
RSTEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLG
YSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVP
PLHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENA
KNIKEKNEKTLATIQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVK
LLDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVHVIEKTKDSVIVEIPDVGL
RGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKET
LPLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYI
NQSVTVYLLRTDDKNQKFLLSLKAPKVKEEKKKVESNIEDPVDSSIKSWDDLSIGSIVKA
KIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHDV
KSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLWL
TISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVDI
NMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNVI
PTTVLSVDEQNKKIELSLRPATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRKV
EAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTYS
DIKAGDVFEGTIKSVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAI
VLKTNPEKKQISLSLKASHFSKEAELASTTTTTTTVDQLEKEDEDEVMADAGFNDSDSES
DIGDQNTEVADRKPETSSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTENKKHKHKR
RKENVVQDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAER
ALKTINFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEIS
EKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEV
VRKFAQLEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIIT
KKITRKQAKFFFNKWLQFEESEGDEKTIEYVKAKATEYVASHESQKADE
Download sequence
Identical sequences N1NXM1 Q05022
YMR229C 4932.YMR229C YMR229C NP_013956.1.97178 YMR229C 5wlc_NJ 5wyj_R2 YR264 YMR229C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]